PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn238371
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family HD-ZIP
Protein Properties Length: 230aa    MW: 25405.4 Da    PI: 7.8142
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn238371genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.23.3e-1970124256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ +++k+q  +Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Achn238371  70 RKKLRLSKDQAAVLEETFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTK 124
                 788899***********************************************98 PP

2HD-ZIP_I/II128.62.7e-4170159191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlsk+q+++LEe+F+e+++L+p++Kv+la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
   Achn238371  70 RKKLRLSKDQAAVLEETFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTEENRRLQKEVNELR-AL 159
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046185.3E-17246IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.603.1E-1855120IPR009057Homeodomain-like
SuperFamilySSF466892.72E-1865127IPR009057Homeodomain-like
PROSITE profilePS5007117.28166126IPR001356Homeobox domain
SMARTSM003899.6E-1668130IPR001356Homeobox domain
PfamPF000461.2E-1670124IPR001356Homeobox domain
CDDcd000865.77E-1570127No hitNo description
PROSITE patternPS000270101124IPR017970Homeobox, conserved site
SMARTSM003401.4E-26126169IPR003106Leucine zipper, homeobox-associated
PfamPF021832.8E-11126160IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MDARSHLRGI DVNRWPSTTA ECEDEVGVSS PNSTISSVSG KREENEAERG WATGGDGGEE  60
EEDGGDTASR KKLRLSKDQA AVLEETFKEH STLNPKQKVA LAKQLNLRPR QVEVWFQNRR  120
ARTKLKQTEV DCEYLKRCCE NLTEENRRLQ KEVNELRALK LSPQAYMHMN PPTTLTMCPS  180
CERVAVLPPS SSASTSTTTP ATGITRHLMP LRSTPGGAWP FNGNNPQAA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16874SRKKLRL
2118126RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002263193.11e-103PREDICTED: homeobox-leucine zipper protein HAT4
SwissprotP466022e-94HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLD7TG791e-103D7TG79_VITVI; Putative uncharacterized protein
STRINGVIT_00s0299g00100.t011e-103(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.19e-79homeobox protein 2